(data stored in ACNUC1104 zone)

EMBL: CP002026.PE528

CP002026.PE528       Location/Qualifiers
FT   CDS             complement(556492..559431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0532"
FT                   /product="transcriptional regulator, winged helix family"
FT                   /note="PFAM: transcriptional regulator domain protein;
FT                   NB-ARC domain protein; KEGG: bja:blr6255 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87865"
FT                   /db_xref="GOA:D7A445"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D7A445"
FT                   /inference="protein motif:PFAM:PF00486"
FT                   /protein_id="ADH87865.1"
FT                   /translation="MIERDAASVGQLSFGPFTFFPGQQLLVEDETPINLGSRARAILLA
FT                   LLEQQGEVVSKAQLIQRAWPDTFVEEANLRVHIGALRRALGDGQDGRRYIVNIPGRGYS
FT                   FVFPVERSDAVGAREMPPALAADSPSLPPALARIVGRSETVQQVKALLVEQRFVSIVGP
FT                   GGIGKSTVAIAVAHEMRGRFSEGVCFVDLSALGDPQLVPAALAAALGVGLRSESPTQSL
FT                   IAATRAKPLLLLLDSCEHVIETVSHLAEQLFGNGGEDLHILATSREPLRVEGERIHRLS
FT                   SLDVPPTRANLSSAEALAYPAVQLFVERAAANLGGFQLTDAEAPLVAYLCRRLDGIALA
FT                   IEIAAGRVESLGVAGLASRLDDRFRLQLQGRRTALRRHQTLSTLLDWSYALLPPFEQLV
FT                   LRQLAILAGNFTMDDAVAIIADDEATDSEIVNAVANLVEKSLITADVHGLQAHYRLLDT
FT                   TRAYAAVKLAESGKVELLRRRHAAIFRDALHRANLAWEIQPAPAWTEDHRHLIDNVRAA
FT                   LDWAFSPKGDAEIGVALTLGAVPLWFQLQLIAESHQQVRLALASTDLDRAPHIQMRLQA
FT                   VLAWSLMQIRGQVDETRTAWERTLELAEALDDRDYQLRALWGLWSGLLNQSRFREALAL
FT                   AHRFAEVAARGSDLNDSYVGYRMIGYILHLLGRQTEARRYLEPMVKGYVVPITGSQIIR
FT                   FVFEQKATGRCFLARILWLQGSFDAAIAEIDDIVASAEASDDRLTLCQVLVQAACPVAF
FT                   FADDLVRARRFVGMLVDESARDGIEFWQVWGQCFAGVLMIREGDLSNGIKSLGEALGRL
FT                   RNISYGVYYIVFLAEYAAALAQVGEFDRALSCLEEALARSEQNEEGWFAPELWRLAGEL
FT                   AALRGGTDAGGEAEQRLATALNIAREQEALFWEIKAAVSLARLWQRQDRVREAEALLAP
FT                   LVSRFAGSLDQPLLREAAELSDRLKTAASPVGKSKYRKPLDGPATRTLQ"
     MIERDAASVG QLSFGPFTFF PGQQLLVEDE TPINLGSRAR AILLALLEQQ GEVVSKAQLI        60
     QRAWPDTFVE EANLRVHIGA LRRALGDGQD GRRYIVNIPG RGYSFVFPVE RSDAVGAREM       120
     PPALAADSPS LPPALARIVG RSETVQQVKA LLVEQRFVSI VGPGGIGKST VAIAVAHEMR       180
     GRFSEGVCFV DLSALGDPQL VPAALAAALG VGLRSESPTQ SLIAATRAKP LLLLLDSCEH       240
     VIETVSHLAE QLFGNGGEDL HILATSREPL RVEGERIHRL SSLDVPPTRA NLSSAEALAY       300
     PAVQLFVERA AANLGGFQLT DAEAPLVAYL CRRLDGIALA IEIAAGRVES LGVAGLASRL       360
     DDRFRLQLQG RRTALRRHQT LSTLLDWSYA LLPPFEQLVL RQLAILAGNF TMDDAVAIIA       420
     DDEATDSEIV NAVANLVEKS LITADVHGLQ AHYRLLDTTR AYAAVKLAES GKVELLRRRH       480
     AAIFRDALHR ANLAWEIQPA PAWTEDHRHL IDNVRAALDW AFSPKGDAEI GVALTLGAVP       540
     LWFQLQLIAE SHQQVRLALA STDLDRAPHI QMRLQAVLAW SLMQIRGQVD ETRTAWERTL       600
     ELAEALDDRD YQLRALWGLW SGLLNQSRFR EALALAHRFA EVAARGSDLN DSYVGYRMIG       660
     YILHLLGRQT EARRYLEPMV KGYVVPITGS QIIRFVFEQK ATGRCFLARI LWLQGSFDAA       720
     IAEIDDIVAS AEASDDRLTL CQVLVQAACP VAFFADDLVR ARRFVGMLVD ESARDGIEFW       780
     QVWGQCFAGV LMIREGDLSN GIKSLGEALG RLRNISYGVY YIVFLAEYAA ALAQVGEFDR       840
     ALSCLEEALA RSEQNEEGWF APELWRLAGE LAALRGGTDA GGEAEQRLAT ALNIAREQEA       900
     LFWEIKAAVS LARLWQRQDR VREAEALLAP LVSRFAGSLD QPLLREAAEL SDRLKTAASP       960
     VGKSKYRKPL DGPATRTLQ                                                    979
//

If you have problems or comments...

PBIL Back to PBIL home page