(data stored in ACNUC1104 zone)

EMBL: CP002026.PE529

CP002026.PE529       Location/Qualifiers
FT   CDS             complement(559532..560323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0533"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: mlo:mll4146 sugar ABC
FT                   transporter permease protein ThuG"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87866"
FT                   /db_xref="GOA:D7A446"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7A446"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADH87866.1"
FT                   /translation="MLRRSLLYWGALLPLLGLNLFPFAVALDTIYRRRGGEDMGAFWAG
FT                   MWLRTELGTSLVNSLVIALATAIASTLVALPAAYALSRFRFRGRRAFSEALLGTQMLTP
FT                   IMLVLGLSQMIAGMGLTDTRFALVLLYSAFQVPFAVWMLRGYIDAIPVELEEAALLDGA
FT                   SRRQILGSIILPLSVPAILVTATFAFITAFNEFVLALTLLRSPANFTLPLRVNALTAGR
FT                   YAVDWPDVMAAVLVASLPVLIMFIGLQRYMLRGLRLSLGAT"
     MLRRSLLYWG ALLPLLGLNL FPFAVALDTI YRRRGGEDMG AFWAGMWLRT ELGTSLVNSL        60
     VIALATAIAS TLVALPAAYA LSRFRFRGRR AFSEALLGTQ MLTPIMLVLG LSQMIAGMGL       120
     TDTRFALVLL YSAFQVPFAV WMLRGYIDAI PVELEEAALL DGASRRQILG SIILPLSVPA       180
     ILVTATFAFI TAFNEFVLAL TLLRSPANFT LPLRVNALTA GRYAVDWPDV MAAVLVASLP       240
     VLIMFIGLQR YMLRGLRLSL GAT                                               263
//

If you have problems or comments...

PBIL Back to PBIL home page