(data stored in ACNUC1104 zone)

EMBL: CP002026.PE530

CP002026.PE530       Location/Qualifiers
FT   CDS             complement(560316..561224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0534"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: mlo:mll4147 sugar ABC
FT                   transporter permease protein ThuF"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87867"
FT                   /db_xref="GOA:D7A447"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7A447"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADH87867.1"
FT                   /translation="MPAADIKSTQSRLTQNRNLLLLLLAPSAMATGLIALVPVLLLVRM
FT                   SLSEVSRFGRIGAYVGWENFARLAADPLLPAILLRTGIWTGSVVAGTVLIALPTALILN
FT                   QRFLGRGLAQFLVLAPWAISVASMAVVWRHALTDEGGLLNRLAVAAGLLDRPIPWLGSV
FT                   PAAFGFEILIAILVSVPFSTVILLAGLSSIPDDLYDAARLDGARAVDRLKFLTLPLLRP
FT                   FIWIVLIFNIAYVTNSFPIIWILTQGGPANGTDILVTYLYKLAFTFGRLDEAAALSILL
FT                   LGGLAALTILMLRALERPAHA"
     MPAADIKSTQ SRLTQNRNLL LLLLAPSAMA TGLIALVPVL LLVRMSLSEV SRFGRIGAYV        60
     GWENFARLAA DPLLPAILLR TGIWTGSVVA GTVLIALPTA LILNQRFLGR GLAQFLVLAP       120
     WAISVASMAV VWRHALTDEG GLLNRLAVAA GLLDRPIPWL GSVPAAFGFE ILIAILVSVP       180
     FSTVILLAGL SSIPDDLYDA ARLDGARAVD RLKFLTLPLL RPFIWIVLIF NIAYVTNSFP       240
     IIWILTQGGP ANGTDILVTY LYKLAFTFGR LDEAAALSIL LLGGLAALTI LMLRALERPA       300
     HA                                                                      302
//

If you have problems or comments...

PBIL Back to PBIL home page