(data stored in ACNUC1104 zone)

EMBL: CP002026.PE531

CP002026.PE531       Location/Qualifiers
FT   CDS             complement(561211..562434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0535"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: oan:Oant_3895 extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87868"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D7A448"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADH87868.1"
FT                   /translation="MTRLAKIFLILSLALLSLGIPGAQAVDLRFTAGEYSGFTRPFLER
FT                   VARDYEVLHPGTRIQIEVIPWDSYLQKLTTDISSGDQPDLSIVPTMWISDLAADGLLEP
FT                   LDGLASPEFKAKFIPAFLVPATVKGQLLGFPAAASARAMVVNTELLQKAGAPEPKTWDA
FT                   LRTAAQKIAALPNTYGFGLPGKEVEVDTYFYYALWGFGGEIIKDGKSGLSSPEAIRAAT
FT                   FYMSLINDKATEPAPTAHSREDIFKLFKEGRIGIIFTYPMLVPQLKTEAPNLKYAVMPF
FT                   PVETKPVTLGVTDVLTMSSSSKNKQEAFDFLQFLYSDKYRTEFDRAEGLLPVTVSEAAS
FT                   SYYKDNPDIAAFAAGLAYARFFPTIKGWPEISDITVRALQTMYLGQKTSTEAMTDAARQ
FT                   IDDVLARR"
     MTRLAKIFLI LSLALLSLGI PGAQAVDLRF TAGEYSGFTR PFLERVARDY EVLHPGTRIQ        60
     IEVIPWDSYL QKLTTDISSG DQPDLSIVPT MWISDLAADG LLEPLDGLAS PEFKAKFIPA       120
     FLVPATVKGQ LLGFPAAASA RAMVVNTELL QKAGAPEPKT WDALRTAAQK IAALPNTYGF       180
     GLPGKEVEVD TYFYYALWGF GGEIIKDGKS GLSSPEAIRA ATFYMSLIND KATEPAPTAH       240
     SREDIFKLFK EGRIGIIFTY PMLVPQLKTE APNLKYAVMP FPVETKPVTL GVTDVLTMSS       300
     SSKNKQEAFD FLQFLYSDKY RTEFDRAEGL LPVTVSEAAS SYYKDNPDIA AFAAGLAYAR       360
     FFPTIKGWPE ISDITVRALQ TMYLGQKTST EAMTDAARQI DDVLARR                     407
//

If you have problems or comments...

PBIL Back to PBIL home page