(data stored in ACNUC1104 zone)

EMBL: CP002026.PE532

CP002026.PE532       Location/Qualifiers
FT   CDS             complement(562903..563268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0536"
FT                   /product="conserved hypothetical protein; putative inner
FT                   membrane protein"
FT                   /note="KEGG: efe:EFER_3975 conserved hypothetical protein;
FT                   putative inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87869"
FT                   /db_xref="GOA:D7A449"
FT                   /db_xref="InterPro:IPR003807"
FT                   /db_xref="UniProtKB/TrEMBL:D7A449"
FT                   /inference="similar to AA sequence:KEGG:EFER_3975"
FT                   /protein_id="ADH87869.1"
FT                   /translation="MPERREARAPGLQPERTALSWSRTGFLALLVAALLGRAGTPAASL
FT                   IELALILLLVPMAGLFLYRGFRIPCDGNAKHDDVAERRSALLFVCLGIAALAGLHGMAT
FT                   LGRIVVYLQSHGIDMRM"
     MPERREARAP GLQPERTALS WSRTGFLALL VAALLGRAGT PAASLIELAL ILLLVPMAGL        60
     FLYRGFRIPC DGNAKHDDVA ERRSALLFVC LGIAALAGLH GMATLGRIVV YLQSHGIDMR       120
     M                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page