(data stored in ACNUC1104 zone)

EMBL: CP002026.PE534

CP002026.PE534       Location/Qualifiers
FT   CDS             complement(563657..564073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0538"
FT                   /product="protein of unknown function DUF126"
FT                   /note="PFAM: protein of unknown function DUF126; KEGG:
FT                   mms:mma_2389 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87871"
FT                   /db_xref="InterPro:IPR002840"
FT                   /db_xref="UniProtKB/TrEMBL:D7A451"
FT                   /inference="protein motif:PFAM:PF01989"
FT                   /protein_id="ADH87871.1"
FT                   /translation="MAQTLLCHPGIGPDVEGIALVASDDFSARYDLDRIKGVFSRPAHK
FT                   LFGEDYRERVLVLNNVKGGVASAWMLNEMASRDVKPAAFVFNRVNPILAQGAALAGLPL
FT                   VDRFADGDVTTLICNGERIRVRPSEGQVILLDRP"
     MAQTLLCHPG IGPDVEGIAL VASDDFSARY DLDRIKGVFS RPAHKLFGED YRERVLVLNN        60
     VKGGVASAWM LNEMASRDVK PAAFVFNRVN PILAQGAALA GLPLVDRFAD GDVTTLICNG       120
     ERIRVRPSEG QVILLDRP                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page