(data stored in ACNUC1104 zone)

EMBL: CP002026.PE536

CP002026.PE536       Location/Qualifiers
FT   CDS             complement(565314..566588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0540"
FT                   /product="TRAP dicarboxylate transporter, DctM subunit"
FT                   /note="KEGG: rpa:RPA1784 TRAP dicarboxylate family
FT                   transporter DctM subunit; TIGRFAM: TRAP dicarboxylate
FT                   transporter, DctM subunit; PFAM: TRAP C4-dicarboxylate
FT                   transport system permease DctM subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87873"
FT                   /db_xref="GOA:D7A453"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:D7A453"
FT                   /inference="protein motif:TFAM:TIGR00786"
FT                   /protein_id="ADH87873.1"
FT                   /translation="MTSGIAITVLFLLLMVASLPVFVAMGIAGFLGFALSKGLDGALYG
FT                   FTETLWQATHVYELIAIPLFILTGTVMQQSGAGRDLFAVVNAFAGRVRNATGVATILAC
FT                   GIFAAICGSSIATAATVGLVAVPALREQGYGDARAGGFVAAGGTLGILIPPSIPLILYG
FT                   IITDTSIGQLFIAGVVPGILMMGVFAAYALWSRPQVVVNGSEGGDRWALLRGSVGVLLL
FT                   PPVIVGAIYLGLFTPTEVGALAVIYVAGLGLLQRRLDGRKLVAAVLAATRTTVMLMMLI
FT                   VFGQYFAHYLTYEEVPQIIAQSITQVPGGPLVTITLVVLVYLLLGMFLESAAMLLISVP
FT                   IFFPVAMAIGMDPLTFGIFAIMAMEIAQISPPVGINLFTIHGISRIPLERLALGVLPFI
FT                   GIQIVFLYLIFFMPEIVLWLPGQMK"
     MTSGIAITVL FLLLMVASLP VFVAMGIAGF LGFALSKGLD GALYGFTETL WQATHVYELI        60
     AIPLFILTGT VMQQSGAGRD LFAVVNAFAG RVRNATGVAT ILACGIFAAI CGSSIATAAT       120
     VGLVAVPALR EQGYGDARAG GFVAAGGTLG ILIPPSIPLI LYGIITDTSI GQLFIAGVVP       180
     GILMMGVFAA YALWSRPQVV VNGSEGGDRW ALLRGSVGVL LLPPVIVGAI YLGLFTPTEV       240
     GALAVIYVAG LGLLQRRLDG RKLVAAVLAA TRTTVMLMML IVFGQYFAHY LTYEEVPQII       300
     AQSITQVPGG PLVTITLVVL VYLLLGMFLE SAAMLLISVP IFFPVAMAIG MDPLTFGIFA       360
     IMAMEIAQIS PPVGINLFTI HGISRIPLER LALGVLPFIG IQIVFLYLIF FMPEIVLWLP       420
     GQMK                                                                    424
//

If you have problems or comments...

PBIL Back to PBIL home page