(data stored in ACNUC1104 zone)

EMBL: CP002026.PE539

CP002026.PE539       Location/Qualifiers
FT   CDS             complement(568152..569594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0543"
FT                   /product="sulfatase"
FT                   /note="PFAM: sulfatase; KEGG: bbr:BB4315 putative
FT                   sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87876"
FT                   /db_xref="GOA:D7A456"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR032506"
FT                   /db_xref="UniProtKB/TrEMBL:D7A456"
FT                   /inference="protein motif:PFAM:PF00884"
FT                   /protein_id="ADH87876.1"
FT                   /translation="MPAPSNVLIIMSDEHNKAITGCYGNAVVATPNIDALAARGTLFEA
FT                   AYTNCPVCVPARASFACGRYVHDIGHWDNADPYDGTQRSWHHHLRASGHEVTSIGKLHF
FT                   RSAADDYGFTESLIPMHVVEEKGDLLGLVRDELPKRKGAWKMARLAGPGESSYTFYDRD
FT                   ILARAQIWLRGAAARARAKPWALFVSFVAPHFPLTAPPEHYYRYYDDARLQWPKLYETQ
FT                   ARPEHPYLREYAECFAYDEHFAGPDDVRRALAGYYGLVGFLDENIGKLLATLDATGLSQ
FT                   DTRVVYVSDHGDNLGARGLWGKSTMYEEAVSVPLIAAGPGFEPGKRVRTPVSLVDLSAS
FT                   ILSWCGEEKPTDWPGEDLAGDLPPDRAVFSEYHGMGSKSGFYMLRDRRFKYVHYVDHRA
FT                   QLFDLEADPQELNDLADDPAFSDVRAQLNARLCAICDPNDTDRRAKARQAEQLHRNGGR
FT                   EAVIARGDLGFSPPPGFSPDFM"
     MPAPSNVLII MSDEHNKAIT GCYGNAVVAT PNIDALAARG TLFEAAYTNC PVCVPARASF        60
     ACGRYVHDIG HWDNADPYDG TQRSWHHHLR ASGHEVTSIG KLHFRSAADD YGFTESLIPM       120
     HVVEEKGDLL GLVRDELPKR KGAWKMARLA GPGESSYTFY DRDILARAQI WLRGAAARAR       180
     AKPWALFVSF VAPHFPLTAP PEHYYRYYDD ARLQWPKLYE TQARPEHPYL REYAECFAYD       240
     EHFAGPDDVR RALAGYYGLV GFLDENIGKL LATLDATGLS QDTRVVYVSD HGDNLGARGL       300
     WGKSTMYEEA VSVPLIAAGP GFEPGKRVRT PVSLVDLSAS ILSWCGEEKP TDWPGEDLAG       360
     DLPPDRAVFS EYHGMGSKSG FYMLRDRRFK YVHYVDHRAQ LFDLEADPQE LNDLADDPAF       420
     SDVRAQLNAR LCAICDPNDT DRRAKARQAE QLHRNGGREA VIARGDLGFS PPPGFSPDFM       480
//

If you have problems or comments...

PBIL Back to PBIL home page