(data stored in ACNUC1104 zone)

EMBL: CP002026.PE540

CP002026.PE540       Location/Qualifiers
FT   CDS             569662..570438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0544"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="KEGG: bbr:BB4313 GntR family transcriptional
FT                   regulator; PFAM: regulatory protein GntR HTH; SMART:
FT                   regulatory protein GntR HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87877"
FT                   /db_xref="GOA:D7A457"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7A457"
FT                   /inference="protein motif:PFAM:PF00392"
FT                   /protein_id="ADH87877.1"
FT                   /translation="MPVVTMERSFPLEAVRDLADRDVSGRAKYAVLTECLRTMILAGNL
FT                   PAGTRLPTERDLATLSGLSLGTVQRALRTLVEEGYLTRTPKLGSFVTERTQIRQPWHCR
FT                   FLAEDGRTVLPVSPTTRKRLVIEEVGPWTAHLGPAAAGYLYIERDFNVAGEFSVDSRFW
FT                   GDANRLSALRSGPVSQLDGENLKHLIASRCHLPVTHVIHKLRYARQGQEPARLILTALT
FT                   WSHEAPLYYQEFTIPPNSRELLVSDEIEQSAAFGIE"
     MPVVTMERSF PLEAVRDLAD RDVSGRAKYA VLTECLRTMI LAGNLPAGTR LPTERDLATL        60
     SGLSLGTVQR ALRTLVEEGY LTRTPKLGSF VTERTQIRQP WHCRFLAEDG RTVLPVSPTT       120
     RKRLVIEEVG PWTAHLGPAA AGYLYIERDF NVAGEFSVDS RFWGDANRLS ALRSGPVSQL       180
     DGENLKHLIA SRCHLPVTHV IHKLRYARQG QEPARLILTA LTWSHEAPLY YQEFTIPPNS       240
     RELLVSDEIE QSAAFGIE                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page