(data stored in ACNUC1104 zone)

EMBL: CP002026.PE544

CP002026.PE544       Location/Qualifiers
FT   CDS             complement(573602..574105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0548"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rpb:RPB_4418 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87881"
FT                   /db_xref="GOA:D7A461"
FT                   /db_xref="UniProtKB/TrEMBL:D7A461"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH87881.1"
FT                   /translation="MNDDRKAKVATGADWIIPVLGAIFATYYLISIKDLDWEAKVSGVF
FT                   CAVMLFGLIGIFALRTAIGLLRGTHYLEFRSLYESHRLAVLRGSLFALTVTSVAVIPWA
FT                   GFTLSTFGFLFACFLWLQRMSVRAAAITAGALALGGYVLFILILRTSFPQGPFESLVST
FT                   LTGL"
     MNDDRKAKVA TGADWIIPVL GAIFATYYLI SIKDLDWEAK VSGVFCAVML FGLIGIFALR        60
     TAIGLLRGTH YLEFRSLYES HRLAVLRGSL FALTVTSVAV IPWAGFTLST FGFLFACFLW       120
     LQRMSVRAAA ITAGALALGG YVLFILILRT SFPQGPFESL VSTLTGL                     167
//

If you have problems or comments...

PBIL Back to PBIL home page