(data stored in ACNUC1104 zone)

EMBL: CP002026.PE545

CP002026.PE545       Location/Qualifiers
FT   CDS             complement(574171..575172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0549"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   dia:Dtpsy_0125 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87882"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:D7A462"
FT                   /inference="protein motif:PFAM:PF03401"
FT                   /protein_id="ADH87882.1"
FT                   /translation="MTIMLDRRHVLMAGAGALAASLARPARAAGDFPDKPIQVLIPTGE
FT                   GGGVDQAARAFNRIWSKYLGANFEYSYFPGASGQVGYEVFISKRPADAYNILFGNIGPE
FT                   MIMYATQKVKYKYQEDFTYIGSMDIDDSVIWVGSSSKFKTIQELVEEGKKREITLSTSR
FT                   LPHPSTIGALALAEATGMKVRMIPYGGGGPARSAAITGEVDGCATFLSSSLGLGDQARF
FT                   LTVFNDTNRAPELTNNAPPVNQALGTKIPQMSGQRAIAIHTKAVEAYPDRVKKLTDSFK
FT                   QVFADPEYKTVAEKAGTPWEFIQYGDAASCQESAKEFVELADRFRSLLTATK"
     MTIMLDRRHV LMAGAGALAA SLARPARAAG DFPDKPIQVL IPTGEGGGVD QAARAFNRIW        60
     SKYLGANFEY SYFPGASGQV GYEVFISKRP ADAYNILFGN IGPEMIMYAT QKVKYKYQED       120
     FTYIGSMDID DSVIWVGSSS KFKTIQELVE EGKKREITLS TSRLPHPSTI GALALAEATG       180
     MKVRMIPYGG GGPARSAAIT GEVDGCATFL SSSLGLGDQA RFLTVFNDTN RAPELTNNAP       240
     PVNQALGTKI PQMSGQRAIA IHTKAVEAYP DRVKKLTDSF KQVFADPEYK TVAEKAGTPW       300
     EFIQYGDAAS CQESAKEFVE LADRFRSLLT ATK                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page