(data stored in ACNUC1104 zone)

EMBL: CP002026.PE55

CP002026.PE55        Location/Qualifiers
FT   CDS             complement(43695..44594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0055"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: mno:Mnod_0259 transcriptional regulator, LysR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87392"
FT                   /db_xref="GOA:D6ZZX8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZX8"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADH87392.1"
FT                   /translation="MIDRFELLLALAKERHFGRAAESCGVTQPTLSAGLKQLEEQLGVR
FT                   LVERGSRFIGFTPEGERALQWARRVIGDVRAMRQEIAGMRKGLSGHLRIAGIPTAMPML
FT                   SELTTPFHEKHGDVRFTLMSASSNEVLRLIENLEADAGVTYLDNDPLGRVKTVPLYQEG
FT                   YRFLTAVDAPLGDRAKVTWEEIGQVPLCLLTPDMQNRRIVDKQLTEAGHAVVPMLEANS
FT                   TLALLSHVRTGKWASVVANTLADVFAFPENIRSIPIEGPEVLHQMGLVVLDREPLTPIV
FT                   TALMAEARAIAPELAARM"
     MIDRFELLLA LAKERHFGRA AESCGVTQPT LSAGLKQLEE QLGVRLVERG SRFIGFTPEG        60
     ERALQWARRV IGDVRAMRQE IAGMRKGLSG HLRIAGIPTA MPMLSELTTP FHEKHGDVRF       120
     TLMSASSNEV LRLIENLEAD AGVTYLDNDP LGRVKTVPLY QEGYRFLTAV DAPLGDRAKV       180
     TWEEIGQVPL CLLTPDMQNR RIVDKQLTEA GHAVVPMLEA NSTLALLSHV RTGKWASVVA       240
     NTLADVFAFP ENIRSIPIEG PEVLHQMGLV VLDREPLTPI VTALMAEARA IAPELAARM        299
//

If you have problems or comments...

PBIL Back to PBIL home page