(data stored in ACNUC1104 zone)

EMBL: CP002026.PE551

CP002026.PE551       Location/Qualifiers
FT   CDS             581144..582721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0555"
FT                   /product="transcriptional regulator domain protein"
FT                   /note="PFAM: transcriptional regulator domain protein;
FT                   KEGG: oca:OCAR_6759 transcriptional regulator, CadC-family"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87888"
FT                   /db_xref="GOA:D7A468"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D7A468"
FT                   /inference="protein motif:PFAM:PF00486"
FT                   /protein_id="ADH87888.1"
FT                   /translation="MKYHFADCVLDLDRRELTRASQSVAVGPQVFDLLVHLVENHERVV
FT                   SKDGLLDAVWNGRIVSESTLTSHINAVRKAIGDSGAEQRLVRTVARKGFRFVGDIQQVG
FT                   MSEASRDAAIMPEIAIPATAVTAHKPSIAVMPFQNLSGDPEQDYFADGVAEEIITALSR
FT                   VRWLFVIARNSSFAYRGRAADVQQISRELGVTYVLEGSVRKAADRIRITGQLVNASTNG
FT                   YLWADRFEGALDDIFTLQDRISGNVVGAIAPQMELAEIERARRKPTENLSAYDCYLRGL
FT                   AHLHRGGRESVEEALPLFRKAIELDGEFAPPYAMAAWGYFWRKVNGWTIDPVQETAEGI
FT                   ALARRGVELGRDDAVVLARAGHALAHLAGEFESGIGLLDRALFLNPNLAPAWFLGGFLR
FT                   VWHGEPEAAIDYFEHAMRLSPVDPELYRMQAGIAMAHLFAGRFETASLWADQAQRNLPS
FT                   FLMAVATGAASQALSGRTEEARRTMDQLRELAPALHISGLKDWLPIRRQEDFALFADGL
FT                   RQAGLPDK"
     MKYHFADCVL DLDRRELTRA SQSVAVGPQV FDLLVHLVEN HERVVSKDGL LDAVWNGRIV        60
     SESTLTSHIN AVRKAIGDSG AEQRLVRTVA RKGFRFVGDI QQVGMSEASR DAAIMPEIAI       120
     PATAVTAHKP SIAVMPFQNL SGDPEQDYFA DGVAEEIITA LSRVRWLFVI ARNSSFAYRG       180
     RAADVQQISR ELGVTYVLEG SVRKAADRIR ITGQLVNAST NGYLWADRFE GALDDIFTLQ       240
     DRISGNVVGA IAPQMELAEI ERARRKPTEN LSAYDCYLRG LAHLHRGGRE SVEEALPLFR       300
     KAIELDGEFA PPYAMAAWGY FWRKVNGWTI DPVQETAEGI ALARRGVELG RDDAVVLARA       360
     GHALAHLAGE FESGIGLLDR ALFLNPNLAP AWFLGGFLRV WHGEPEAAID YFEHAMRLSP       420
     VDPELYRMQA GIAMAHLFAG RFETASLWAD QAQRNLPSFL MAVATGAASQ ALSGRTEEAR       480
     RTMDQLRELA PALHISGLKD WLPIRRQEDF ALFADGLRQA GLPDK                       525
//

If you have problems or comments...

PBIL Back to PBIL home page