(data stored in ACNUC1104 zone)

EMBL: CP002026.PE552

CP002026.PE552       Location/Qualifiers
FT   CDS             complement(583367..583876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0556"
FT                   /product="protein of unknown function DUF995"
FT                   /note="PFAM: protein of unknown function DUF995; KEGG:
FT                   rhi:NGR_b17890 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87889"
FT                   /db_xref="InterPro:IPR009337"
FT                   /db_xref="UniProtKB/TrEMBL:D7A469"
FT                   /inference="protein motif:PFAM:PF06191"
FT                   /protein_id="ADH87889.1"
FT                   /translation="MRTSTLTLAAIAVSLTCTLSASADAAQRRATATVMRPNDVRALYA
FT                   GKTWIWSDGAAYFAPNRRFVAWSGSGKQASYAEGEWRVTPLGRMCFSAIWRGVGPSGRN
FT                   ITCFGHRVMGGQVIYQQKEPGGAWYVFKHGQTAAGDEYAKFRAGDEASAGVGKVKQELK
FT                   LLSARS"
     MRTSTLTLAA IAVSLTCTLS ASADAAQRRA TATVMRPNDV RALYAGKTWI WSDGAAYFAP        60
     NRRFVAWSGS GKQASYAEGE WRVTPLGRMC FSAIWRGVGP SGRNITCFGH RVMGGQVIYQ       120
     QKEPGGAWYV FKHGQTAAGD EYAKFRAGDE ASAGVGKVKQ ELKLLSARS                   169
//

If you have problems or comments...

PBIL Back to PBIL home page