(data stored in ACNUC1104 zone)

EMBL: CP002026.PE555

CP002026.PE555       Location/Qualifiers
FT   CDS             complement(586284..588227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0559"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   smd:Smed_3671 putative cellulose synthase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87892"
FT                   /db_xref="GOA:D7A472"
FT                   /db_xref="InterPro:IPR025993"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D7A472"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADH87892.1"
FT                   /translation="MNEVPPLILSAADDRPEAFADRRRYNRPRAALVPLLSPPQRVELF
FT                   LAISAWTAAYLFFWLWWLDPAHITSVGRFIFASLPFAWLTLMPIYFFTVFVGSRKPAGL
FT                   AQLPEGSTVAMVVTKAPSEPFEVVARTLEAMIAQPYPHDTWLADEDPSAETLDWCATHG
FT                   VRVSTRRGVDDYQREEWPRRVRCKEGNLAYFYDHFGYRLYDFVVQMDADHVPSRHYLER
FT                   MLAPFSDPRIGYVSAPSICNRNAGESWAARARLYAEASMHGPLQAGYTGGWAPLCIGSH
FT                   YAVRTEALETIGGLGPELAEDHSTTLMMNAGGWRGVHAIDAIANGDGPRSFADLATQEF
FT                   QWARSLVTILLRYSPALVPLLPARLRFQFLFCQLWYPLYSSIWAVLFLMPVVALASREH
FT                   FADVTYYDFVVHYAPMSVVLLCMIYRWRAGGWLRPANARVLSWEEILFVLAKWPWSLLG
FT                   TIYALRDFFTGSFVDFRVTPKGKGTVEPVPLRVVAPYVAISLGSAAPVLLLDDAGPASG
FT                   FYIFAIVNAVLYAVLVLVILVRHRIENPEGRGPRGRRPMEVGLVAALLALPLTAAVQRG
FT                   PEGLGALAWGALPVSYTYTVFSAAGAGLGYGTRKLIFVMPWAERPQQGTPSPSVDQQAD
FT                   QSPHRRNSGRTQ"
     MNEVPPLILS AADDRPEAFA DRRRYNRPRA ALVPLLSPPQ RVELFLAISA WTAAYLFFWL        60
     WWLDPAHITS VGRFIFASLP FAWLTLMPIY FFTVFVGSRK PAGLAQLPEG STVAMVVTKA       120
     PSEPFEVVAR TLEAMIAQPY PHDTWLADED PSAETLDWCA THGVRVSTRR GVDDYQREEW       180
     PRRVRCKEGN LAYFYDHFGY RLYDFVVQMD ADHVPSRHYL ERMLAPFSDP RIGYVSAPSI       240
     CNRNAGESWA ARARLYAEAS MHGPLQAGYT GGWAPLCIGS HYAVRTEALE TIGGLGPELA       300
     EDHSTTLMMN AGGWRGVHAI DAIANGDGPR SFADLATQEF QWARSLVTIL LRYSPALVPL       360
     LPARLRFQFL FCQLWYPLYS SIWAVLFLMP VVALASREHF ADVTYYDFVV HYAPMSVVLL       420
     CMIYRWRAGG WLRPANARVL SWEEILFVLA KWPWSLLGTI YALRDFFTGS FVDFRVTPKG       480
     KGTVEPVPLR VVAPYVAISL GSAAPVLLLD DAGPASGFYI FAIVNAVLYA VLVLVILVRH       540
     RIENPEGRGP RGRRPMEVGL VAALLALPLT AAVQRGPEGL GALAWGALPV SYTYTVFSAA       600
     GAGLGYGTRK LIFVMPWAER PQQGTPSPSV DQQADQSPHR RNSGRTQ                     647
//

If you have problems or comments...

PBIL Back to PBIL home page