(data stored in ACNUC1104 zone)

EMBL: CP002026.PE556

CP002026.PE556       Location/Qualifiers
FT   CDS             complement(588224..589210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0560"
FT                   /product="UDP-glucose 4-epimerase"
FT                   /note="KEGG: bov:BOV_A0474 UDP-glucose 4-epimerase;
FT                   TIGRFAM: UDP-glucose 4-epimerase; PFAM: NAD-dependent
FT                   epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87893"
FT                   /db_xref="GOA:D7A473"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7A473"
FT                   /inference="protein motif:TFAM:TIGR01179"
FT                   /protein_id="ADH87893.1"
FT                   /translation="MNAPRILVTGGAGYIGSHACKALAANGFRPVAFDNLSLGHRDAVR
FT                   WGPFVHGDILDTQRLAEAMRAHGISAVIHFAALAYVGESVSIPARYYRTNVGGTLSLLE
FT                   ACRLAEVRHLVFSSSCATYGIPDHLPVSESAEQCPINPYGRTKLVAEEMLADEANANGL
FT                   HFAILRYFNAAGADPQLELGERHDPETHVVPLAIMAALGQAGPLAIYGDDYPTADGTCV
FT                   RDFVHVSDLAEAHVRALDHLLSGGHNLTANLGSGTGTSILQLIRAVERQMNCGVPIHVA
FT                   PRRSGDPPALYADITRARDLLGFAPRHSDLDAIVATAVRYHANGGLS"
     MNAPRILVTG GAGYIGSHAC KALAANGFRP VAFDNLSLGH RDAVRWGPFV HGDILDTQRL        60
     AEAMRAHGIS AVIHFAALAY VGESVSIPAR YYRTNVGGTL SLLEACRLAE VRHLVFSSSC       120
     ATYGIPDHLP VSESAEQCPI NPYGRTKLVA EEMLADEANA NGLHFAILRY FNAAGADPQL       180
     ELGERHDPET HVVPLAIMAA LGQAGPLAIY GDDYPTADGT CVRDFVHVSD LAEAHVRALD       240
     HLLSGGHNLT ANLGSGTGTS ILQLIRAVER QMNCGVPIHV APRRSGDPPA LYADITRARD       300
     LLGFAPRHSD LDAIVATAVR YHANGGLS                                          328
//

If you have problems or comments...

PBIL Back to PBIL home page