(data stored in ACNUC1104 zone)

EMBL: CP002026.PE558

CP002026.PE558       Location/Qualifiers
FT   CDS             complement(590642..591994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0562"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="KEGG: bbt:BBta_3472 signal transduction histidine
FT                   kinase; PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; SMART: ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87895"
FT                   /db_xref="GOA:D7A475"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D7A475"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADH87895.1"
FT                   /translation="MSLGSRSWSLKRRLATRLLVVLAIAVLGPPIAFLFFSWWTVGSLH
FT                   HRALQDQAADIVRGLDTRVTPPVLTLPEVLAAAYTRSNDSYFYLVLERDGTVVTASSPL
FT                   AASLATNATIVPPGEFFLVPRAGGAPWYTYSTNADGYRIVVAQDSSHENVLFDSIVREV
FT                   AGFTLWLALPLLLVALLVMMHTLNRAFRPIARAAEDARTITPGGQEAQISAHGLPREIT
FT                   PLVKAVNAALARLARAYDVERRFTTDAAHELRTPVAVLMARIDMLPEGPAKESLVLDTA
FT                   RLSRSVSQLLQVARLDAKPLAIDEDIDLARVVRHAVALLGPLAMQDGRRMEMTAPNRPI
FT                   MVRGNAQAIALAVTNLVENALSHTPAGTPIDVQVTSEPAIYVLDRGQGVPPDERMAIFE
FT                   RFQRSPNTASSGTGLGLAIVAEIAARHHAVASVEARAGGGSIFAIRWINSA"
     MSLGSRSWSL KRRLATRLLV VLAIAVLGPP IAFLFFSWWT VGSLHHRALQ DQAADIVRGL        60
     DTRVTPPVLT LPEVLAAAYT RSNDSYFYLV LERDGTVVTA SSPLAASLAT NATIVPPGEF       120
     FLVPRAGGAP WYTYSTNADG YRIVVAQDSS HENVLFDSIV REVAGFTLWL ALPLLLVALL       180
     VMMHTLNRAF RPIARAAEDA RTITPGGQEA QISAHGLPRE ITPLVKAVNA ALARLARAYD       240
     VERRFTTDAA HELRTPVAVL MARIDMLPEG PAKESLVLDT ARLSRSVSQL LQVARLDAKP       300
     LAIDEDIDLA RVVRHAVALL GPLAMQDGRR MEMTAPNRPI MVRGNAQAIA LAVTNLVENA       360
     LSHTPAGTPI DVQVTSEPAI YVLDRGQGVP PDERMAIFER FQRSPNTASS GTGLGLAIVA       420
     EIAARHHAVA SVEARAGGGS IFAIRWINSA                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page