(data stored in ACNUC1104 zone)

EMBL: CP002026.PE559

CP002026.PE559       Location/Qualifiers
FT   CDS             complement(591991..592665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0563"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="KEGG: xau:Xaut_1280 two component transcriptional
FT                   regulator; PFAM: response regulator receiver;
FT                   transcriptional regulator domain protein; SMART: response
FT                   regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87896"
FT                   /db_xref="GOA:D7A476"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D7A476"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADH87896.1"
FT                   /translation="MRLLLVEDERELAGLLDAGLRAAGFAVDRARTVADAEAALNTEGY
FT                   DIAVLDLRLPDGDGLDLLRRQRARGLAIPVLILTARDNLADRVRGLEQGGDDYVLKPFH
FT                   MDELVARLRALLRRPNQALGANIIVGNVALNTADRSVTVSHAPLPLSRRELGLLELFMR
FT                   RSGRVLTRECIERALYSFDDELESNAVEVLLHRLRRKLTGAGASPEIHTLRGIGYLLEE
FT                   AS"
     MRLLLVEDER ELAGLLDAGL RAAGFAVDRA RTVADAEAAL NTEGYDIAVL DLRLPDGDGL        60
     DLLRRQRARG LAIPVLILTA RDNLADRVRG LEQGGDDYVL KPFHMDELVA RLRALLRRPN       120
     QALGANIIVG NVALNTADRS VTVSHAPLPL SRRELGLLEL FMRRSGRVLT RECIERALYS       180
     FDDELESNAV EVLLHRLRRK LTGAGASPEI HTLRGIGYLL EEAS                        224
//

If you have problems or comments...

PBIL Back to PBIL home page