(data stored in ACNUC1104 zone)

EMBL: CP002026.PE56

CP002026.PE56        Location/Qualifiers
FT   CDS             complement(44858..46054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0056"
FT                   /product="protein of unknown function DUF195"
FT                   /note="PFAM: protein of unknown function DUF195; KEGG:
FT                   xau:Xaut_3306 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87393"
FT                   /db_xref="GOA:D6ZZX9"
FT                   /db_xref="InterPro:IPR003798"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZX9"
FT                   /inference="protein motif:PFAM:PF02646"
FT                   /protein_id="ADH87393.1"
FT                   /translation="MDQVLFVVGTHPVTLAQAIAGAAALGFLLLVLVLRAVSRNARQSA
FT                   LEADEQARRADELETRLVELARTQAETVGRVQSMAEVLAQRQGELARAVAERLDATTHR
FT                   MGESLARSAEATHENLAKLNERLALVDQARLSLGELSGQVMSLRETLANKQARGAFGEG
FT                   RLQALVSDGLPRDSFAFQHTLANGRRADCAIFLPGDKRPLLVDSKFPLEAVTAFREAQT
FT                   DDARKQAQTRLKGDVGKHVKDIAERYLVSGETQDIALMFVPSESVYAELHEHFDEVIQQ
FT                   AFRARVVIVSPSLLMLAVQVVQAICKDARMREQADLIRAECGKLVADVIRLRDRVGNLQ
FT                   KHFGQVNEDVAQALTSADKIAKRGARIEQLEFEGEAIPATEPELPDTLPMLGLRGAAE"
     MDQVLFVVGT HPVTLAQAIA GAAALGFLLL VLVLRAVSRN ARQSALEADE QARRADELET        60
     RLVELARTQA ETVGRVQSMA EVLAQRQGEL ARAVAERLDA TTHRMGESLA RSAEATHENL       120
     AKLNERLALV DQARLSLGEL SGQVMSLRET LANKQARGAF GEGRLQALVS DGLPRDSFAF       180
     QHTLANGRRA DCAIFLPGDK RPLLVDSKFP LEAVTAFREA QTDDARKQAQ TRLKGDVGKH       240
     VKDIAERYLV SGETQDIALM FVPSESVYAE LHEHFDEVIQ QAFRARVVIV SPSLLMLAVQ       300
     VVQAICKDAR MREQADLIRA ECGKLVADVI RLRDRVGNLQ KHFGQVNEDV AQALTSADKI       360
     AKRGARIEQL EFEGEAIPAT EPELPDTLPM LGLRGAAE                               398
//

If you have problems or comments...

PBIL Back to PBIL home page