(data stored in ACNUC1104 zone)

EMBL: CP002026.PE560

CP002026.PE560       Location/Qualifiers
FT   CDS             complement(593110..595233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0564"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: EAL domain
FT                   protein; GGDEF domain containing protein; KEGG:
FT                   mpo:Mpop_4323 diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s); SMART: EAL domain protein; GGDEF domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87897"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:D7A477"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADH87897.1"
FT                   /translation="MSGPCPKSAGRTGARLGDRNFAGLLDIMRDGFAVFDDQDRLIFHN
FT                   RRFLELFPFLEALGDLQGLTFYALASVPSGEWRWAPDPEKYVAQRLQRHAEADGEPFLI
FT                   PLENGGWVQARERRTPDGWTVSTWSDVSGLKAAETRLDDAIDGIPAGLILLDAEDRIEL
FT                   VNSGMRRIFAGADVALEAGQRLPEVLDGAEAKGFFALGPGDGAIRERLARSAQQPVEIA
FT                   LRDGGWILASHRRLPNGGTVGIWTDLTTQKKREAELIAMREQLRQHTEALADFARLIAQ
FT                   QARNDMLTGLPNRFALEERLDQLLRDGETGNLWVGVIDVDHFKGINDAVGHAAADDLLR
FT                   EVGRFLRGHLRGDDMLARIGADEFAMVLTELDEGEVMGIANRLHAATHSHVFRIGGHRF
FT                   SLTVSVGLSLAQPDRHSAASLLAAADTACRVAKEAGRDRVQIYDLGDPKVSTTQQRLGW
FT                   AERIRLGLELNRFTLHLQAIVDEKHRILGYEALIRLRNEDGAYCSPAQFLPAARRLGLM
FT                   GRIDSWVCRQCVGYAMQLIATGSDQYVSMNLGVHTLANIAFQSRLLDLVRTNPGVEQAL
FT                   RIEITETDEIYDAPQVSAFLAEMRELGMHVSLDDFGNGYNSFEALKQLPVDGIKIDWTV
FT                   TRDLLHDPIDEAQIRAAVSIAHSLGLELVIEGVEEEAQLVRLKELGATLFQGFYFHRPI
FT                   DAADIFEALPLAR"
     MSGPCPKSAG RTGARLGDRN FAGLLDIMRD GFAVFDDQDR LIFHNRRFLE LFPFLEALGD        60
     LQGLTFYALA SVPSGEWRWA PDPEKYVAQR LQRHAEADGE PFLIPLENGG WVQARERRTP       120
     DGWTVSTWSD VSGLKAAETR LDDAIDGIPA GLILLDAEDR IELVNSGMRR IFAGADVALE       180
     AGQRLPEVLD GAEAKGFFAL GPGDGAIRER LARSAQQPVE IALRDGGWIL ASHRRLPNGG       240
     TVGIWTDLTT QKKREAELIA MREQLRQHTE ALADFARLIA QQARNDMLTG LPNRFALEER       300
     LDQLLRDGET GNLWVGVIDV DHFKGINDAV GHAAADDLLR EVGRFLRGHL RGDDMLARIG       360
     ADEFAMVLTE LDEGEVMGIA NRLHAATHSH VFRIGGHRFS LTVSVGLSLA QPDRHSAASL       420
     LAAADTACRV AKEAGRDRVQ IYDLGDPKVS TTQQRLGWAE RIRLGLELNR FTLHLQAIVD       480
     EKHRILGYEA LIRLRNEDGA YCSPAQFLPA ARRLGLMGRI DSWVCRQCVG YAMQLIATGS       540
     DQYVSMNLGV HTLANIAFQS RLLDLVRTNP GVEQALRIEI TETDEIYDAP QVSAFLAEMR       600
     ELGMHVSLDD FGNGYNSFEA LKQLPVDGIK IDWTVTRDLL HDPIDEAQIR AAVSIAHSLG       660
     LELVIEGVEE EAQLVRLKEL GATLFQGFYF HRPIDAADIF EALPLAR                     707
//

If you have problems or comments...

PBIL Back to PBIL home page