(data stored in ACNUC1104 zone)

EMBL: CP002026.PE563

CP002026.PE563       Location/Qualifiers
FT   CDS             complement(596231..598156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0567"
FT                   /product="putative glycosyltransferase"
FT                   /note="KEGG: azc:AZC_0377 putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87900"
FT                   /db_xref="GOA:D7A480"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="UniProtKB/TrEMBL:D7A480"
FT                   /inference="similar to AA sequence:KEGG:AZC_0377"
FT                   /protein_id="ADH87900.1"
FT                   /translation="MTPQAGGTEPEWGTAAPSLDLPVEAAGAPDRLSTADRFYALRRAR
FT                   RLGVGVDEVLLAAGHASADELARGAAHALGVPFEPLDAVAPLRLNTDSIAALLKSGLMR
FT                   YADGRVVLATRGLRLRQLAGTLARRPELRGQLRLTTPERLAAYVQRSFAGQLGWRAANE
FT                   LKRRHPELSAGTLRESRYVFAVLVMAMVALFTPLGQMSALGIWLSVPLLSFLLFGGALL
FT                   KFAACSLPPQSASPPMRRDAALPPYTLVVPLYREARVVPQLVDALDALDYPREKLQILL
FT                   VVEPDDAETATALAIRADWPGFEVIVAPALGPRTKPKAMNVALPFARGTYVGVYDAEDI
FT                   PDPLQLREVCTVFAAPGSERLGCVQARLAIDNLADGWITRQFAAEYAGYFDVVLPMLAT
FT                   CRLPLPLGGTSNHFRRDALEGVGAWDPYNVTEDADLGVRLAASGWQTAVIASTTDEEAP
FT                   RRFGAWMRQRTRWYKGWMQTLLVHARRPRRLARGAGLTGALALVFLLGSGVAAALINPF
FT                   LILGVLLDLWTQPASDLSPGALVLDWISLCVLVLGYASAMTAIALGMRRRRVPGLWRVL
FT                   PLVPVYWLMMSAAAWRALFHLVIAPYRWEKTDHGLARTSHRRPHIIRLPLRGSGAARRR
FT                   RRRAAA"
     MTPQAGGTEP EWGTAAPSLD LPVEAAGAPD RLSTADRFYA LRRARRLGVG VDEVLLAAGH        60
     ASADELARGA AHALGVPFEP LDAVAPLRLN TDSIAALLKS GLMRYADGRV VLATRGLRLR       120
     QLAGTLARRP ELRGQLRLTT PERLAAYVQR SFAGQLGWRA ANELKRRHPE LSAGTLRESR       180
     YVFAVLVMAM VALFTPLGQM SALGIWLSVP LLSFLLFGGA LLKFAACSLP PQSASPPMRR       240
     DAALPPYTLV VPLYREARVV PQLVDALDAL DYPREKLQIL LVVEPDDAET ATALAIRADW       300
     PGFEVIVAPA LGPRTKPKAM NVALPFARGT YVGVYDAEDI PDPLQLREVC TVFAAPGSER       360
     LGCVQARLAI DNLADGWITR QFAAEYAGYF DVVLPMLATC RLPLPLGGTS NHFRRDALEG       420
     VGAWDPYNVT EDADLGVRLA ASGWQTAVIA STTDEEAPRR FGAWMRQRTR WYKGWMQTLL       480
     VHARRPRRLA RGAGLTGALA LVFLLGSGVA AALINPFLIL GVLLDLWTQP ASDLSPGALV       540
     LDWISLCVLV LGYASAMTAI ALGMRRRRVP GLWRVLPLVP VYWLMMSAAA WRALFHLVIA       600
     PYRWEKTDHG LARTSHRRPH IIRLPLRGSG AARRRRRRAA A                           641
//

If you have problems or comments...

PBIL Back to PBIL home page