(data stored in ACNUC1104 zone)

EMBL: CP002026.PE566

CP002026.PE566       Location/Qualifiers
FT   CDS             600988..601554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0570"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xau:Xaut_1403 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87903"
FT                   /db_xref="GOA:D7A483"
FT                   /db_xref="UniProtKB/TrEMBL:D7A483"
FT                   /inference="similar to AA sequence:KEGG:Xaut_1403"
FT                   /protein_id="ADH87903.1"
FT                   /translation="MAKREKGRIDLRVDDPQQLLDMLDPYPFRERGLDGDVDEYICEHA
FT                   AETAPGHRLAIAIHLPAAVTGSERALGLPGIMQRHFERQAERRSSDLAHLFALGRKMLL
FT                   IGLIVLGVCLVVGQFLVGLFPGSRLAEVVMEGLVILGWVANWRPMEIFLFDWWPLVRER
FT                   RLYRRLAHADISVVAYEAARPSASH"
     MAKREKGRID LRVDDPQQLL DMLDPYPFRE RGLDGDVDEY ICEHAAETAP GHRLAIAIHL        60
     PAAVTGSERA LGLPGIMQRH FERQAERRSS DLAHLFALGR KMLLIGLIVL GVCLVVGQFL       120
     VGLFPGSRLA EVVMEGLVIL GWVANWRPME IFLFDWWPLV RERRLYRRLA HADISVVAYE       180
     AARPSASH                                                                188
//

If you have problems or comments...

PBIL Back to PBIL home page