(data stored in ACNUC1104 zone)

EMBL: CP002026.PE567

CP002026.PE567       Location/Qualifiers
FT   CDS             complement(601572..603263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0571"
FT                   /product="thiamine pyrophosphate protein domain protein
FT                   TPP-binding protein"
FT                   /note="PFAM: thiamine pyrophosphate protein domain protein
FT                   TPP-binding; thiamine pyrophosphate protein TPP binding
FT                   domain protein; thiamine pyrophosphate protein central
FT                   region; KEGG: mrd:Mrad2831_2117 thiamine pyrophosphate
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87904"
FT                   /db_xref="GOA:D7A484"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D7A484"
FT                   /inference="protein motif:PFAM:PF02775"
FT                   /protein_id="ADH87904.1"
FT                   /translation="MNAAHSPSARTGAHLLVDALIANGVTRAFGVPGESYLDVLDALSD
FT                   TEVDFVVCRQEGGAAMMAEASGKLTGRPGICFVTRGPGATNASAGVHIAQQDSTPMILF
FT                   VGQISRSMRGREAFQEVDYRAVFGTLAKWAVEIDEAARIPEIIARAFRVAMQGRPGPVV
FT                   IALPEDVLSEYADVPDAPPVEPAETWPGLTDMMRLQKLLWEAERPIMIVGGTRWNPKAV
FT                   AALVRFAERCDLPVAVSFRRQMLFPADHPCYAGDVGLGINPKLVGRLKEADLVIVAGGR
FT                   LGEVPSQGYSLFPIPDPGVPFVHVHAEADELGRVYQPTLAINASNAAFAAALEGVQPPH
FT                   VVPWDDWREAVRDDYLAWTEEPPANPGAVQMATLVRYLRALPDDTTICNGAGNFATWVH
FT                   RFHRFRAYGTQLAPTSGSMGYGFPAAVAAKRAHPERTVVAVCGDGDFLMTGQEFATAVQ
FT                   YGIPVIAVVIDNGMYGTIRMHQEREFPTRVYGTALKNPDFAAYARAFGGFGVTVETDAE
FT                   FTPALEAALAAGLPAVVHVKLDPEAITPTMTLSALREKALADRSVG"
     MNAAHSPSAR TGAHLLVDAL IANGVTRAFG VPGESYLDVL DALSDTEVDF VVCRQEGGAA        60
     MMAEASGKLT GRPGICFVTR GPGATNASAG VHIAQQDSTP MILFVGQISR SMRGREAFQE       120
     VDYRAVFGTL AKWAVEIDEA ARIPEIIARA FRVAMQGRPG PVVIALPEDV LSEYADVPDA       180
     PPVEPAETWP GLTDMMRLQK LLWEAERPIM IVGGTRWNPK AVAALVRFAE RCDLPVAVSF       240
     RRQMLFPADH PCYAGDVGLG INPKLVGRLK EADLVIVAGG RLGEVPSQGY SLFPIPDPGV       300
     PFVHVHAEAD ELGRVYQPTL AINASNAAFA AALEGVQPPH VVPWDDWREA VRDDYLAWTE       360
     EPPANPGAVQ MATLVRYLRA LPDDTTICNG AGNFATWVHR FHRFRAYGTQ LAPTSGSMGY       420
     GFPAAVAAKR AHPERTVVAV CGDGDFLMTG QEFATAVQYG IPVIAVVIDN GMYGTIRMHQ       480
     EREFPTRVYG TALKNPDFAA YARAFGGFGV TVETDAEFTP ALEAALAAGL PAVVHVKLDP       540
     EAITPTMTLS ALREKALADR SVG                                               563
//

If you have problems or comments...

PBIL Back to PBIL home page