(data stored in ACNUC1104 zone)

EMBL: CP002026.PE569

CP002026.PE569       Location/Qualifiers
FT   CDS             complement(603840..604235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0573"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hne:HNE_3363 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87906"
FT                   /db_xref="UniProtKB/TrEMBL:D7A486"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH87906.1"
FT                   /translation="MSTAIRLPSLRVSALTLAGALAFVTPALAHHGWSWAESEQMTLQG
FT                   TIKTISMSPPHPTLHVTASDGVVWQVDLGNPRQTADSGFTGDTAKPGDAITVLGNRDRD
FT                   SAKPHMKAVRLTLAGKNYDMYPERITN"
     MSTAIRLPSL RVSALTLAGA LAFVTPALAH HGWSWAESEQ MTLQGTIKTI SMSPPHPTLH        60
     VTASDGVVWQ VDLGNPRQTA DSGFTGDTAK PGDAITVLGN RDRDSAKPHM KAVRLTLAGK       120
     NYDMYPERIT N                                                            131
//

If you have problems or comments...

PBIL Back to PBIL home page