(data stored in ACNUC1104 zone)

EMBL: CP002026.PE59

CP002026.PE59        Location/Qualifiers
FT   CDS             47674..48123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0059"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bbr:BB0221 acetyltransferase (GNAT) family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87396"
FT                   /db_xref="GOA:D6ZZY2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR032962"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZY2"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADH87396.1"
FT                   /translation="MTTIRRVEEADHAVWLPLWQGYLTFYEAELPAAVTRTTWQRLLDP
FT                   AEPVHGALAFDEDGRAVGLAHWLFHRSTWSEGNSCYLNDLFVDPGLRGKGVGRALIDHV
FT                   HADAAAKGSPKVYWLTHETNTTAQRLYNAVAERTGFMQYRKMTGC"
     MTTIRRVEEA DHAVWLPLWQ GYLTFYEAEL PAAVTRTTWQ RLLDPAEPVH GALAFDEDGR        60
     AVGLAHWLFH RSTWSEGNSC YLNDLFVDPG LRGKGVGRAL IDHVHADAAA KGSPKVYWLT       120
     HETNTTAQRL YNAVAERTGF MQYRKMTGC                                         149
//

If you have problems or comments...

PBIL Back to PBIL home page