(data stored in ACNUC1104 zone)

EMBL: CP002026.PE62

CP002026.PE62        Location/Qualifiers
FT   CDS             complement(49475..50095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0062"
FT                   /product="putative phage repressor"
FT                   /note="PFAM: Peptidase S24/S26A/S26B, conserved region;
FT                   KEGG: nwi:Nwi_0466 peptidase S24"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87399"
FT                   /db_xref="GOA:D6ZZY5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZY5"
FT                   /inference="protein motif:PFAM:PF00717"
FT                   /protein_id="ADH87399.1"
FT                   /translation="MLTHAQIWRAIDQLAERHGLSASALAKRAGLDPTTFNRSKREQPD
FT                   GRARWPSTESIAKILAATGASLDDFMALIGGGTRRAIPLIGFAQAGRGGYFDDAGFPVG
FT                   GAWDEIEFPNVGDEHAYALEIAGDSMLPLYRDGDVVVVSPAAATRRGDRVIVKTREGEV
FT                   MAKELKRRTAKTVELRSLNPEHADRVFQEGEIAWIARVLWASQ"
     MLTHAQIWRA IDQLAERHGL SASALAKRAG LDPTTFNRSK REQPDGRARW PSTESIAKIL        60
     AATGASLDDF MALIGGGTRR AIPLIGFAQA GRGGYFDDAG FPVGGAWDEI EFPNVGDEHA       120
     YALEIAGDSM LPLYRDGDVV VVSPAAATRR GDRVIVKTRE GEVMAKELKR RTAKTVELRS       180
     LNPEHADRVF QEGEIAWIAR VLWASQ                                            206
//

If you have problems or comments...

PBIL Back to PBIL home page