(data stored in ACNUC1104 zone)

EMBL: CP002026.PE63

CP002026.PE63        Location/Qualifiers
FT   CDS             50227..51660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0063"
FT                   /product="Pyridoxal-dependent decarboxylase"
FT                   /note="PFAM: Pyridoxal-dependent decarboxylase; KEGG:
FT                   smd:Smed_4423 pyridoxal-dependent decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87400"
FT                   /db_xref="GOA:D6ZZY6"
FT                   /db_xref="InterPro:IPR002129"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZY6"
FT                   /inference="protein motif:PFAM:PF00282"
FT                   /protein_id="ADH87400.1"
FT                   /translation="MLAKNEEREATRALLASAARHASAFRAADPLRHAPSFTYEEAVVA
FT                   FDGALSEEGEPAGEVLDDLVRRAGPGLSATTGPRFFGWVIGGSHPVGLAADWLTAAWGQ
FT                   NAANHVAAPAAAAAETVAARWLLDVLRLPEEASVGFVTGATMANFVGLAAARGEVLRRV
FT                   GWDVEEDGLAGAPPVRVVIGDDAHASVFSALQYLGFGRSNLIRVATDAQGAMRADAFER
FT                   ALPESGPVIVVTQAGQINTGAFDPHEAIVPLAKARGAWVHVDGAFGLWARACPKKADLA
FT                   AGVELADSWATDGHKWLQTPYDCGYAIVRDAEAHRRAMTIAASYLPPVSGTERDPSHYV
FT                   PELSRRARGFATWALLRHLGRAGVAAMVAANCEQARLMAELLRAEPGIAVLNEVVLNQV
FT                   LLRFGAEADDAAGDALTLATISAIQAEGTCFAGGAKWRGRWAMRISVSNAVTTQEDIRL
FT                   SAEAIIRCWRSVASSAARG"
     MLAKNEEREA TRALLASAAR HASAFRAADP LRHAPSFTYE EAVVAFDGAL SEEGEPAGEV        60
     LDDLVRRAGP GLSATTGPRF FGWVIGGSHP VGLAADWLTA AWGQNAANHV AAPAAAAAET       120
     VAARWLLDVL RLPEEASVGF VTGATMANFV GLAAARGEVL RRVGWDVEED GLAGAPPVRV       180
     VIGDDAHASV FSALQYLGFG RSNLIRVATD AQGAMRADAF ERALPESGPV IVVTQAGQIN       240
     TGAFDPHEAI VPLAKARGAW VHVDGAFGLW ARACPKKADL AAGVELADSW ATDGHKWLQT       300
     PYDCGYAIVR DAEAHRRAMT IAASYLPPVS GTERDPSHYV PELSRRARGF ATWALLRHLG       360
     RAGVAAMVAA NCEQARLMAE LLRAEPGIAV LNEVVLNQVL LRFGAEADDA AGDALTLATI       420
     SAIQAEGTCF AGGAKWRGRW AMRISVSNAV TTQEDIRLSA EAIIRCWRSV ASSAARG          477
//

If you have problems or comments...

PBIL Back to PBIL home page