(data stored in ACNUC1104 zone)

EMBL: CP002026.PE64

CP002026.PE64        Location/Qualifiers
FT   CDS             51701..52054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0064"
FT                   /product="protein of unknown function DUF952"
FT                   /note="PFAM: protein of unknown function DUF952; KEGG:
FT                   mrd:Mrad2831_0548 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87401"
FT                   /db_xref="InterPro:IPR009297"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZY7"
FT                   /inference="protein motif:PFAM:PF06108"
FT                   /protein_id="ADH87401.1"
FT                   /translation="MTDSLIYKIAPRALWQAAEAAGRFEGAPVDVADGFIHFSTSAQVA
FT                   ETAAKHFAGQDDLLLVAVRTERLDPALLRYEPSRGGDLFPHLYGPLDLQAVAWVRELPL
FT                   GPHGRHLFPAFEG"
     MTDSLIYKIA PRALWQAAEA AGRFEGAPVD VADGFIHFST SAQVAETAAK HFAGQDDLLL        60
     VAVRTERLDP ALLRYEPSRG GDLFPHLYGP LDLQAVAWVR ELPLGPHGRH LFPAFEG          117
//

If you have problems or comments...

PBIL Back to PBIL home page