(data stored in ACNUC1104 zone)

EMBL: CP002026.PE65

CP002026.PE65        Location/Qualifiers
FT   CDS             52058..53149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0065"
FT                   /product="dihydroorotate dehydrogenase"
FT                   /EC_number="1.3.98.1"
FT                   /note="TIGRFAM: dihydroorotate dehydrogenase; KEGG:
FT                   rpb:RPB_4622 dihydroorotate dehydrogenase 2; PFAM:
FT                   dihydroorotate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87402"
FT                   /db_xref="GOA:D6ZZY8"
FT                   /db_xref="InterPro:IPR001295"
FT                   /db_xref="InterPro:IPR005719"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZY8"
FT                   /inference="protein motif:TFAM:TIGR01036"
FT                   /protein_id="ADH87402.1"
FT                   /translation="MSALFDLALPFARLMDPENAHRLAIRALACLPPRAPEPDDARLKV
FT                   EAFGLRFPNPVGLAAGFDKEAEVPDAMLGAGFGFVEVGTITPRPQSGNPRPRNFRLTED
FT                   RAVINRYGFNSGGHGPAKARLIARKGKSRNSAGIVGVNVGANKETVDRAADYVAGIEAF
FT                   AGLGDYFTVNVSSPNTPGLRDLQEETALDDLLARCVEARDRHAPGVPLLLKIAPDLALP
FT                   HLDGVVEVAHRRRVDGLIVSNTTISRPPGLRSPHKGETGGLSGRPLFALSTRMLAETYV
FT                   RADGAFPIIGVGGIDSAETAFAKIEAGASLIQLYSGLVYEGLGLVPRIKAGLLARLAKE
FT                   HATLAEITGRRARQVVAEPFPGA"
     MSALFDLALP FARLMDPENA HRLAIRALAC LPPRAPEPDD ARLKVEAFGL RFPNPVGLAA        60
     GFDKEAEVPD AMLGAGFGFV EVGTITPRPQ SGNPRPRNFR LTEDRAVINR YGFNSGGHGP       120
     AKARLIARKG KSRNSAGIVG VNVGANKETV DRAADYVAGI EAFAGLGDYF TVNVSSPNTP       180
     GLRDLQEETA LDDLLARCVE ARDRHAPGVP LLLKIAPDLA LPHLDGVVEV AHRRRVDGLI       240
     VSNTTISRPP GLRSPHKGET GGLSGRPLFA LSTRMLAETY VRADGAFPII GVGGIDSAET       300
     AFAKIEAGAS LIQLYSGLVY EGLGLVPRIK AGLLARLAKE HATLAEITGR RARQVVAEPF       360
     PGA                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page