(data stored in ACNUC1104 zone)

EMBL: CP002026.PE67

CP002026.PE67        Location/Qualifiers
FT   CDS             complement(54477..54746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0067"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xau:Xaut_1466 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87404"
FT                   /db_xref="GOA:D6ZZZ0"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZZ0"
FT                   /inference="similar to AA sequence:KEGG:Xaut_1466"
FT                   /protein_id="ADH87404.1"
FT                   /translation="MAENQFSRWMGGSPFWVLLRLIALSVVVGVILSALGLDPMNILSS
FT                   LERLVRHLFNFGFDTVERLWRYFLLGAAIVIPLWLITRLANRGR"
     MAENQFSRWM GGSPFWVLLR LIALSVVVGV ILSALGLDPM NILSSLERLV RHLFNFGFDT        60
     VERLWRYFLL GAAIVIPLWL ITRLANRGR                                          89
//

If you have problems or comments...

PBIL Back to PBIL home page