(data stored in ACNUC1104 zone)

EMBL: CP002026.PE7

CP002026.PE7         Location/Qualifiers
FT   CDS             4536..5234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0007"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rsh:Rsph17029_3297 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87344"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZT0"
FT                   /inference="similar to AA sequence:KEGG:Rsph17029_3297"
FT                   /protein_id="ADH87344.1"
FT                   /translation="MTGIVVDRFAGHNPAPMRILIGCETSGVVRRAFAAYGHDVWSVDL
FT                   LPAEDRSNRHIIGDIRDYLGEGWDLLAVMHPPCTRLCNSGVRWLRKAPPGRTLEEMWAD
FT                   LEEGAALFSDCWNAPIERICVENPVMHRYARERIRNWAKPQTVQPWWFGESAFKATGLY
FT                   LRGLPPLVPTRKLVPPKKGTDEHKSWSKVHRASPGPERWKDRSRTYDGVAEAMAAQWTA
FT                   AWAREREAAE"
     MTGIVVDRFA GHNPAPMRIL IGCETSGVVR RAFAAYGHDV WSVDLLPAED RSNRHIIGDI        60
     RDYLGEGWDL LAVMHPPCTR LCNSGVRWLR KAPPGRTLEE MWADLEEGAA LFSDCWNAPI       120
     ERICVENPVM HRYARERIRN WAKPQTVQPW WFGESAFKAT GLYLRGLPPL VPTRKLVPPK       180
     KGTDEHKSWS KVHRASPGPE RWKDRSRTYD GVAEAMAAQW TAAWAREREA AE               232
//

If you have problems or comments...

PBIL Back to PBIL home page