(data stored in ACNUC1104 zone)

EMBL: CP002026.PE75

CP002026.PE75        Location/Qualifiers
FT   CDS             65627..66055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0075"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="KEGG: azc:AZC_0511 regulatory protein; PFAM:
FT                   Transcription regulator MerR DNA binding; regulatory
FT                   protein MerR; SMART: regulatory protein MerR"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87412"
FT                   /db_xref="GOA:D6ZZZ8"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZZ8"
FT                   /inference="protein motif:PFAM:PF09278"
FT                   /protein_id="ADH87412.1"
FT                   /translation="MDFTSFEAERTADTHAAPSGENAFFTIGDLAREFGVTLRALRFYE
FT                   DKGLLAPRREGLTRLYSPAERSRLAIILKGKKLGFTLAEIKAMVALREGTAPAGGLALT
FT                   REKCVEQLALLETQKTEIEEAIGELRQMVAAFSSRSAA"
     MDFTSFEAER TADTHAAPSG ENAFFTIGDL AREFGVTLRA LRFYEDKGLL APRREGLTRL        60
     YSPAERSRLA IILKGKKLGF TLAEIKAMVA LREGTAPAGG LALTREKCVE QLALLETQKT       120
     EIEEAIGELR QMVAAFSSRS AA                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page