(data stored in ACNUC1104 zone)

EMBL: CP002026.PE76

CP002026.PE76        Location/Qualifiers
FT   CDS             66179..66793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0076"
FT                   /product="DSBA oxidoreductase"
FT                   /note="PFAM: DSBA oxidoreductase; KEGG: azc:AZC_0543
FT                   2-hydroxychromene-2-carboxylate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87413"
FT                   /db_xref="GOA:D6ZZZ9"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR014440"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZZ9"
FT                   /inference="protein motif:PFAM:PF01323"
FT                   /protein_id="ADH87413.1"
FT                   /translation="MSRSIDYYFSIASPWAFIGHSPFLDVAKRHGARINFRPVFLGELF
FT                   ADTGGLPLARRHPARQRYRLVELKRWREARGLDFHLSPAHWPLDPAAADRLVIAAQIAG
FT                   HDVAPLVSRLTSGVWQRQENMADPAALGVVLAELGLPAELLEASAGDRTAVIYKANHDA
FT                   AVEADVFGSPAYVLDGEVFWGQDRIDMLERALSSGRAPFTP"
     MSRSIDYYFS IASPWAFIGH SPFLDVAKRH GARINFRPVF LGELFADTGG LPLARRHPAR        60
     QRYRLVELKR WREARGLDFH LSPAHWPLDP AAADRLVIAA QIAGHDVAPL VSRLTSGVWQ       120
     RQENMADPAA LGVVLAELGL PAELLEASAG DRTAVIYKAN HDAAVEADVF GSPAYVLDGE       180
     VFWGQDRIDM LERALSSGRA PFTP                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page