(data stored in ACNUC1104 zone)

EMBL: CP002026.PE77

CP002026.PE77        Location/Qualifiers
FT   CDS             66822..67376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0077"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nha:Nham_0271 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87414"
FT                   /db_xref="UniProtKB/TrEMBL:D7A000"
FT                   /inference="similar to AA sequence:KEGG:Nham_0271"
FT                   /protein_id="ADH87414.1"
FT                   /translation="MRLTLIGAGLALAMLHPAQAQAPNIPPNGPPEAARFTMQPVEGGL
FT                   MKLDTSTGAMSFCSAKAGAWVCEAVPEDRAALEAEIARLQARIAVLEKSRAGTGTGGTG
FT                   TGVPDIMAPPSAEAPKDTPKDEPLGPPDAAKPAPKSEQELSEEARKRLDQAMDMVEQVF
FT                   RRFFDMVDQLRREEGAQDQKL"
     MRLTLIGAGL ALAMLHPAQA QAPNIPPNGP PEAARFTMQP VEGGLMKLDT STGAMSFCSA        60
     KAGAWVCEAV PEDRAALEAE IARLQARIAV LEKSRAGTGT GGTGTGVPDI MAPPSAEAPK       120
     DTPKDEPLGP PDAAKPAPKS EQELSEEARK RLDQAMDMVE QVFRRFFDMV DQLRREEGAQ       180
     DQKL                                                                    184
//

If you have problems or comments...

PBIL Back to PBIL home page