(data stored in ACNUC1104 zone)

EMBL: CP002026.PE78

CP002026.PE78        Location/Qualifiers
FT   CDS             complement(67381..68373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0078"
FT                   /product="Alpha/beta hydrolase fold-3 domain protein"
FT                   /note="PFAM: Alpha/beta hydrolase fold-3 domain protein;
FT                   KEGG: xau:Xaut_1452 alpha/beta hydrolase domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87415"
FT                   /db_xref="GOA:D7A001"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D7A001"
FT                   /inference="protein motif:PFAM:PF07859"
FT                   /protein_id="ADH87415.1"
FT                   /translation="MSSPLPETRASSAAPLVVDPALFEEAAITPETRAINAGIVKALGA
FT                   VPDRWVFPMAMLRKLRLEGKGPFPLAPESSYAQVIEIDGPHGPVPLRILTPPTPPKGVY
FT                   LHIHGGGWCLGSARENDGLNHRFVERTGFAVVSVEYRLAPEEPWPRGPDDCEAAALWLM
FT                   HEGPARFGTDRFAIGGESAGANLSVAVLLRLRDKHGLTPFRAANLTAGAYDLGLTPSAR
FT                   QWGDEPLVLNTRDINVFVGHYLREGGDIALPDISPLQANLKDLPPALFTIGTRDALLDD
FT                   TLFMAPRWLKAGNAAELAIYPGGCHVFIGFPGSLADQALARSHAFVSAC"
     MSSPLPETRA SSAAPLVVDP ALFEEAAITP ETRAINAGIV KALGAVPDRW VFPMAMLRKL        60
     RLEGKGPFPL APESSYAQVI EIDGPHGPVP LRILTPPTPP KGVYLHIHGG GWCLGSAREN       120
     DGLNHRFVER TGFAVVSVEY RLAPEEPWPR GPDDCEAAAL WLMHEGPARF GTDRFAIGGE       180
     SAGANLSVAV LLRLRDKHGL TPFRAANLTA GAYDLGLTPS ARQWGDEPLV LNTRDINVFV       240
     GHYLREGGDI ALPDISPLQA NLKDLPPALF TIGTRDALLD DTLFMAPRWL KAGNAAELAI       300
     YPGGCHVFIG FPGSLADQAL ARSHAFVSAC                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page