(data stored in ACNUC1104 zone)

EMBL: CP002026.PE79

CP002026.PE79        Location/Qualifiers
FT   CDS             68490..68954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0079"
FT                   /product="protein of unknown function UPF0047"
FT                   /note="PFAM: protein of unknown function UPF0047; KEGG:
FT                   rpb:RPB_4567 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87416"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="InterPro:IPR035917"
FT                   /db_xref="UniProtKB/TrEMBL:D7A002"
FT                   /inference="protein motif:PFAM:PF01894"
FT                   /protein_id="ADH87416.1"
FT                   /translation="MARISRGELRESTVTRRFTAMLAVDTPGRGFTDITGAVADFLIAA
FT                   GASEGEVSVFCRHTSASLAIQENADPDVRVDLLTALDRLAPEDAGWAHDMEGPDDMPAH
FT                   VKAMLSGISLSVPVIGGRMALGTWQGLYLIEHRARPHQRELVVAFVGEAY"
     MARISRGELR ESTVTRRFTA MLAVDTPGRG FTDITGAVAD FLIAAGASEG EVSVFCRHTS        60
     ASLAIQENAD PDVRVDLLTA LDRLAPEDAG WAHDMEGPDD MPAHVKAMLS GISLSVPVIG       120
     GRMALGTWQG LYLIEHRARP HQRELVVAFV GEAY                                   154
//

If you have problems or comments...

PBIL Back to PBIL home page