(data stored in ACNUC1104 zone)

EMBL: CP002026.PE8

CP002026.PE8         Location/Qualifiers
FT   CDS             5231..6295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0008"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mno:Mnod_7350 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87345"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZT1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH87345.1"
FT                   /translation="MSNYAQGWVENLDVVLGSSTRFVLMALANYANDANLAWVSRSTIV
FT                   KYTELSPATVTRALRDLEARGLIEREERFRDNGSRTTDMIRLLVGCTPRPATPPDHSDE
FT                   GGTDHHDEAPSSPRAGPLITVMRPEPSLEPSIEDSPQAPQGAGVGISKSDGEGEGGAPD
FT                   TQFDVFWAQYGADPTASKAKALRSWARLGASERAQALALLPRFLDHCRAKSRRICDPST
FT                   YIAERRWEGLANVPAPAARAEEAPARPVEADPVKRAVLWALNDKADRGEWHFVEQGSDA
FT                   WEAWRQAFGAAGFGHRWMAGRVVREPAPGGGIVQRLGRSFPLRYPPKADGSGTGPPDGT
FT                   VTADEMAEFVNSGG"
     MSNYAQGWVE NLDVVLGSST RFVLMALANY ANDANLAWVS RSTIVKYTEL SPATVTRALR        60
     DLEARGLIER EERFRDNGSR TTDMIRLLVG CTPRPATPPD HSDEGGTDHH DEAPSSPRAG       120
     PLITVMRPEP SLEPSIEDSP QAPQGAGVGI SKSDGEGEGG APDTQFDVFW AQYGADPTAS       180
     KAKALRSWAR LGASERAQAL ALLPRFLDHC RAKSRRICDP STYIAERRWE GLANVPAPAA       240
     RAEEAPARPV EADPVKRAVL WALNDKADRG EWHFVEQGSD AWEAWRQAFG AAGFGHRWMA       300
     GRVVREPAPG GGIVQRLGRS FPLRYPPKAD GSGTGPPDGT VTADEMAEFV NSGG             354
//

If you have problems or comments...

PBIL Back to PBIL home page