(data stored in ACNUC1104 zone)

EMBL: CP002026.PE82

CP002026.PE82        Location/Qualifiers
FT   CDS             73483..73911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0082"
FT                   /product="large conductance mechanosensitive channel
FT                   protein"
FT                   /note="KEGG: xau:Xaut_0055 large conductance
FT                   mechanosensitive channel protein; TIGRFAM: large
FT                   conductance mechanosensitive channel protein; PFAM:
FT                   large-conductance mechanosensitive channel"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87419"
FT                   /db_xref="GOA:D7A005"
FT                   /db_xref="InterPro:IPR001185"
FT                   /db_xref="InterPro:IPR019823"
FT                   /db_xref="InterPro:IPR036019"
FT                   /db_xref="InterPro:IPR037673"
FT                   /db_xref="UniProtKB/TrEMBL:D7A005"
FT                   /inference="protein motif:TFAM:TIGR00220"
FT                   /protein_id="ADH87419.1"
FT                   /translation="MSKVLTEFREFAVKGNVVDLAIGVIIGAAFGQIVTSVVSDLFMPV
FT                   VGAIFGGLDFSNYFVGLSSQVTANNLTAAREQGAVFAYGHFLTVVINFLIVAWILFLVV
FT                   KGINRLRRNAANEPPPPAPPTKEEVLLTEIRDLLAKKV"
     MSKVLTEFRE FAVKGNVVDL AIGVIIGAAF GQIVTSVVSD LFMPVVGAIF GGLDFSNYFV        60
     GLSSQVTANN LTAAREQGAV FAYGHFLTVV INFLIVAWIL FLVVKGINRL RRNAANEPPP       120
     PAPPTKEEVL LTEIRDLLAK KV                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page