(data stored in ACNUC1104 zone)

EMBL: CP002026.PE85

CP002026.PE85        Location/Qualifiers
FT   CDS             75785..76678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0085"
FT                   /product="dTDP-4-dehydrorhamnose reductase"
FT                   /EC_number="1.1.1.133"
FT                   /note="TIGRFAM: dTDP-4-dehydrorhamnose reductase; KEGG:
FT                   azc:AZC_1832 dTDP-4-dehydrorhamnose reductase; PFAM:
FT                   dTDP-4-dehydrorhamnose reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87422"
FT                   /db_xref="GOA:D7A008"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7A008"
FT                   /inference="protein motif:TFAM:TIGR01214"
FT                   /protein_id="ADH87422.1"
FT                   /translation="MTRVLLLGAGGQVGREIAALAPGRVESLTALDHAGLDITDASALK
FT                   AALEQYRPQVVINAAAYTAVDKAESEPEKANLINAVAPGLIAQACASHGAGLIHISTDY
FT                   VFDGTKAGAYVESDPVAPLGVYGASKEAGERAVRDSLDRHLIVRTSWVYGVHGANFLKT
FT                   MLRLAETRDRLTVVADQTGCPTATRDIAEGLLTAAMQLATADVTPGTYHLAGTGVTTWH
FT                   GFASVIVAHAARHTGRHVEVAPITTADYPTPARRPANSELSSALFARTVGYEAAPWQLR
FT                   AAEVVDALFAAKQEAP"
     MTRVLLLGAG GQVGREIAAL APGRVESLTA LDHAGLDITD ASALKAALEQ YRPQVVINAA        60
     AYTAVDKAES EPEKANLINA VAPGLIAQAC ASHGAGLIHI STDYVFDGTK AGAYVESDPV       120
     APLGVYGASK EAGERAVRDS LDRHLIVRTS WVYGVHGANF LKTMLRLAET RDRLTVVADQ       180
     TGCPTATRDI AEGLLTAAMQ LATADVTPGT YHLAGTGVTT WHGFASVIVA HAARHTGRHV       240
     EVAPITTADY PTPARRPANS ELSSALFART VGYEAAPWQL RAAEVVDALF AAKQEAP          297
//

If you have problems or comments...

PBIL Back to PBIL home page