(data stored in ACNUC1104 zone)

EMBL: CP002026.PE87

CP002026.PE87        Location/Qualifiers
FT   CDS             77672..78880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0087"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   xau:Xaut_0300 aspartate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87424"
FT                   /db_xref="GOA:D7A010"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D7A010"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ADH87424.1"
FT                   /translation="MPASLAPSFTPSPLVDHVRPQALALPESGIVEVFNYGRTREGLIP
FT                   LWAGEGDLPTPSFIAEAATRSLAAGETFYTWQRGIPDLRAAIASYMTRLYGVAEDPERY
FT                   FVTGSGMHAVQVALALTVSAGEEVIIPSPEWPNIAAAAEAAGARPVYVPFSFDAGRGFR
FT                   LDLDRLESAVTPRTRAIFINTPANPTGYVASLDELRGVLDIARRHGLWIIADEIYGRFY
FT                   YAAGEGGLAPSFHSIMEPEERILFVQTFSKNWAMTGWRVGWLEAHPSLGDVIENLIQYS
FT                   NSGVAAFMQRAGVAALERGESFVAHQIERAKRGRDIVAEGLASSNRVRFAQPEGAFYMF
FT                   FGVEGEDDTRQLALKLVDEANIGLAPGTAFGPGGEEYIRLCFARGEAQVAEATDRLVRW
FT                   LKR"
     MPASLAPSFT PSPLVDHVRP QALALPESGI VEVFNYGRTR EGLIPLWAGE GDLPTPSFIA        60
     EAATRSLAAG ETFYTWQRGI PDLRAAIASY MTRLYGVAED PERYFVTGSG MHAVQVALAL       120
     TVSAGEEVII PSPEWPNIAA AAEAAGARPV YVPFSFDAGR GFRLDLDRLE SAVTPRTRAI       180
     FINTPANPTG YVASLDELRG VLDIARRHGL WIIADEIYGR FYYAAGEGGL APSFHSIMEP       240
     EERILFVQTF SKNWAMTGWR VGWLEAHPSL GDVIENLIQY SNSGVAAFMQ RAGVAALERG       300
     ESFVAHQIER AKRGRDIVAE GLASSNRVRF AQPEGAFYMF FGVEGEDDTR QLALKLVDEA       360
     NIGLAPGTAF GPGGEEYIRL CFARGEAQVA EATDRLVRWL KR                          402
//

If you have problems or comments...

PBIL Back to PBIL home page