(data stored in ACNUC1104 zone)

EMBL: CP002026.PE89

CP002026.PE89        Location/Qualifiers
FT   CDS             80106..80723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0089"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="KEGG: bbt:BBta_0530 two component LuxR family
FT                   transcriptional regulator; PFAM: response regulator
FT                   receiver; regulatory protein LuxR; SMART: response
FT                   regulator receiver; regulatory protein LuxR"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87426"
FT                   /db_xref="GOA:D7A012"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D7A012"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADH87426.1"
FT                   /translation="MAQLGEVFIVDDDSAVRDALSLVLSLEGYHVRSFSDGAAFLSVAR
FT                   THVPACIVLDVHMPGRSGLDILKELEADRYPAPIFIISGQGDIPMAVDAIRHGALDFIE
FT                   KPFDADTVVERVRDAIEAHSRRGSSEPGDLLTAHFPGHEMLTPREREVLVQIASGASNK
FT                   EAGRKLGISPRTIEVHRARIMEKLGAKNAADLVRIVLKDMRA"
     MAQLGEVFIV DDDSAVRDAL SLVLSLEGYH VRSFSDGAAF LSVARTHVPA CIVLDVHMPG        60
     RSGLDILKEL EADRYPAPIF IISGQGDIPM AVDAIRHGAL DFIEKPFDAD TVVERVRDAI       120
     EAHSRRGSSE PGDLLTAHFP GHEMLTPRER EVLVQIASGA SNKEAGRKLG ISPRTIEVHR       180
     ARIMEKLGAK NAADLVRIVL KDMRA                                             205
//

If you have problems or comments...

PBIL Back to PBIL home page