(data stored in ACNUC1104 zone)

EMBL: CP002026.PE95

CP002026.PE95        Location/Qualifiers
FT   CDS             complement(85930..86433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0095"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rhi:NGR_b03860 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87432"
FT                   /db_xref="UniProtKB/TrEMBL:D7A018"
FT                   /inference="similar to AA sequence:KEGG:NGR_b03860"
FT                   /protein_id="ADH87432.1"
FT                   /translation="MHRGHDHHHHDHGAGGHSHSHSHSHAHHAAPNHGHSPRPAAQWQT
FT                   PHLPEPPEDSDHAHVETDIDLVEKAFVEGFAGASDPTSFLRLANVPFDAITTDGTRVSL
FT                   LRVETDEVTDVGAVMPHLGGGSFRYDPLPAQMVSRRKRLRFVYFDGRQTLPLTLAEVRT
FT                   LAQT"
     MHRGHDHHHH DHGAGGHSHS HSHSHAHHAA PNHGHSPRPA AQWQTPHLPE PPEDSDHAHV        60
     ETDIDLVEKA FVEGFAGASD PTSFLRLANV PFDAITTDGT RVSLLRVETD EVTDVGAVMP       120
     HLGGGSFRYD PLPAQMVSRR KRLRFVYFDG RQTLPLTLAE VRTLAQT                     167
//

If you have problems or comments...

PBIL Back to PBIL home page