(data stored in ACNUC1104 zone)

EMBL: CP002026.PE98

CP002026.PE98        Location/Qualifiers
FT   CDS             complement(88875..89540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0098"
FT                   /product="uracil phosphoribosyltransferase"
FT                   /EC_number="2.4.2.9"
FT                   /note="TIGRFAM: uracil phosphoribosyltransferase; KEGG:
FT                   hna:Hneap_0843 uracil phosphoribosyltransferase; PFAM:
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87435"
FT                   /db_xref="GOA:D7A021"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR034332"
FT                   /db_xref="UniProtKB/TrEMBL:D7A021"
FT                   /inference="protein motif:TFAM:TIGR01091"
FT                   /protein_id="ADH87435.1"
FT                   /translation="MNAPTVLTDVALPPTTIVVDHPLIQHKLTLMRRSRTPANEFRLLL
FT                   REISMLLAYEVTRDMPTELIEIETPLATMQAPILSGKKLCLVSVLRAGGGILEGMLEIL
FT                   PAARVGHVGLYRDPVSLQAVEYYLKLPRDISERTAIVLDPMLATGNSAVAAVSEVKAAG
FT                   CQSIKFVCLIAAPEGLKVMHEAHPDVTVYAAAVDSHLNDHGYIVPGIGDAGDRIFGTK"
     MNAPTVLTDV ALPPTTIVVD HPLIQHKLTL MRRSRTPANE FRLLLREISM LLAYEVTRDM        60
     PTELIEIETP LATMQAPILS GKKLCLVSVL RAGGGILEGM LEILPAARVG HVGLYRDPVS       120
     LQAVEYYLKL PRDISERTAI VLDPMLATGN SAVAAVSEVK AAGCQSIKFV CLIAAPEGLK       180
     VMHEAHPDVT VYAAAVDSHL NDHGYIVPGI GDAGDRIFGT K                           221
//

If you have problems or comments...

PBIL Back to PBIL home page