(data stored in SCRATCH3701 zone)

EMBL: CP002031.ATPA

CP002031.ATPA        Location/Qualifiers
FT   CDS             93331..94842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpA"
FT                   /locus_tag="KN400_0086"
FT                   /product="ATP synthase F1, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82949"
FT                   /protein_id="ADI82949.1"
FT                   /translation="MEIRAEEISEIIRKQIKEYGKEVEVAETGTIISVGDGIARIHGLD
FT                   KAMAGELLEFPGGVSGMVLNLEEDNVGAAILGEDNENIKEGTTVKRTGRIVEVPVGEAL
FT                   IGRVVNAIGQPIDGKGPINTTTFGKVEVKAPGIVKRKSVHQPMQTGLKAIDSMVPIGRG
FT                   QRELIIGDRQTGKTAVAIDTIINQKGGDLICIYVAIGQKRSTVAQVVSKLQEYGAMDYT
FT                   IVVSASASEPAPLQFIAPYTGVTMGEYFRDNGKHALIIYDDLSKQAVAYRQLSLLLRRP
FT                   PGREAYPGDVFYLHSRLLERAAKLSDDCGAGSLTALPIIETQAGDVSAYIPTNVISITD
FT                   GQIYLESDLFYSGVRPAINVGLSVSRVGGSAQVKAMKQVAGTLRLNLAQYREMAAFAQF
FT                   GSDLDKATQMQLARGERLVEILKQPQYRPIPNEKQVLVIFAANNGFVDEYPVSSLRRYE
FT                   SELYSFFDSRKADILAELRDKKAIDDDLKAKMIAALEELKKEFTA"
     MEIRAEEISE IIRKQIKEYG KEVEVAETGT IISVGDGIAR IHGLDKAMAG ELLEFPGGVS        60
     GMVLNLEEDN VGAAILGEDN ENIKEGTTVK RTGRIVEVPV GEALIGRVVN AIGQPIDGKG       120
     PINTTTFGKV EVKAPGIVKR KSVHQPMQTG LKAIDSMVPI GRGQRELIIG DRQTGKTAVA       180
     IDTIINQKGG DLICIYVAIG QKRSTVAQVV SKLQEYGAMD YTIVVSASAS EPAPLQFIAP       240
     YTGVTMGEYF RDNGKHALII YDDLSKQAVA YRQLSLLLRR PPGREAYPGD VFYLHSRLLE       300
     RAAKLSDDCG AGSLTALPII ETQAGDVSAY IPTNVISITD GQIYLESDLF YSGVRPAINV       360
     GLSVSRVGGS AQVKAMKQVA GTLRLNLAQY REMAAFAQFG SDLDKATQMQ LARGERLVEI       420
     LKQPQYRPIP NEKQVLVIFA ANNGFVDEYP VSSLRRYESE LYSFFDSRKA DILAELRDKK       480
     AIDDDLKAKM IAALEELKKE FTA                                               503
//

If you have problems or comments...

PBIL Back to PBIL home page