(data stored in SCRATCH3701 zone)

EMBL: CP002031.ATPB

CP002031.ATPB        Location/Qualifiers
FT   CDS             complement(330627..331316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpB"
FT                   /locus_tag="KN400_0302"
FT                   /product="ATP synthase F0, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83165"
FT                   /protein_id="ADI83165.1"
FT                   /translation="MVHPLLFLQFFRKLLEPLHISEAGADAIAYTWLIIVCLLIVSLIA
FT                   TKALKAVPTGMQNFMEVVIGGIENMVEETMGEKGKPYFPLIATLALFVLVSNLIGLIPG
FT                   FFPPTANLNTTAACAVIVFLSTHIVGIKKHGFHYLQHFMGPIWWLAPLMFFIEIIGHLS
FT                   RPLSLSLRLFGNMNGHELVLMIFFALAPFLVPLPMMLMGVLVSFIQAFVFMLLAMIYIQ
FT                   GSLEEAH"
     MVHPLLFLQF FRKLLEPLHI SEAGADAIAY TWLIIVCLLI VSLIATKALK AVPTGMQNFM        60
     EVVIGGIENM VEETMGEKGK PYFPLIATLA LFVLVSNLIG LIPGFFPPTA NLNTTAACAV       120
     IVFLSTHIVG IKKHGFHYLQ HFMGPIWWLA PLMFFIEIIG HLSRPLSLSL RLFGNMNGHE       180
     LVLMIFFALA PFLVPLPMML MGVLVSFIQA FVFMLLAMIY IQGSLEEAH                   229
//

If you have problems or comments...

PBIL Back to PBIL home page