(data stored in SCRATCH3701 zone)

EMBL: CP002031.ATPD

CP002031.ATPD        Location/Qualifiers
FT   CDS             95785..97197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpD"
FT                   /locus_tag="KN400_0088"
FT                   /product="ATP synthase F1, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82951"
FT                   /protein_id="ADI82951.1"
FT                   /translation="MSQNFGKISQVIGAVIDVEFEPGKLPPIYNALRVTNPAIDDKEYN
FT                   LVLEVAQHLGENAVRTIAMDSTDGLVRGQAVLDTGKQISVPVGRKTLGRILNVIGEPVD
FT                   EMGPVNAEKEYGIHREAPAFVDQSTKVEAFTTGIKVVDLLAPYARGGKIGLFGGAGVGK
FT                   TVLIMELINNIAKQHGGFSVFAGVGERTREGNDLWMEMKESGVLDKAALVYGQMNEPPG
FT                   ARARVALSALSIAEYFRDEEGQNVLLFVDNIFRFTQAGSEVSALLGRIPSAVGYQPTLA
FT                   TEMGELQERITSTTKGSITSVQAIYVPADDLTDPAPATAFAHLDATTVLSRQIAELGIY
FT                   PAVDPLDSTSRILDPQVIGEEHYSIARQVQYVLQKYKDLQDIIAILGMDELSEEDKLVV
FT                   ARARKIQRFLSQPFHVAEAFTGSPGKYVELKDTIKGFQEIVAGKHDDVPEQAFYMVGTI
FT                   EEALEKAKKLAA"
     MSQNFGKISQ VIGAVIDVEF EPGKLPPIYN ALRVTNPAID DKEYNLVLEV AQHLGENAVR        60
     TIAMDSTDGL VRGQAVLDTG KQISVPVGRK TLGRILNVIG EPVDEMGPVN AEKEYGIHRE       120
     APAFVDQSTK VEAFTTGIKV VDLLAPYARG GKIGLFGGAG VGKTVLIMEL INNIAKQHGG       180
     FSVFAGVGER TREGNDLWME MKESGVLDKA ALVYGQMNEP PGARARVALS ALSIAEYFRD       240
     EEGQNVLLFV DNIFRFTQAG SEVSALLGRI PSAVGYQPTL ATEMGELQER ITSTTKGSIT       300
     SVQAIYVPAD DLTDPAPATA FAHLDATTVL SRQIAELGIY PAVDPLDSTS RILDPQVIGE       360
     EHYSIARQVQ YVLQKYKDLQ DIIAILGMDE LSEEDKLVVA RARKIQRFLS QPFHVAEAFT       420
     GSPGKYVELK DTIKGFQEIV AGKHDDVPEQ AFYMVGTIEE ALEKAKKLAA                  470
//

If you have problems or comments...

PBIL Back to PBIL home page