(data stored in SCRATCH3701 zone)

EMBL: CP002031.ATPE

CP002031.ATPE        Location/Qualifiers
FT   CDS             complement(330292..330567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpE"
FT                   /locus_tag="KN400_0301"
FT                   /product="ATP synthase F0, C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83164"
FT                   /protein_id="ADI83164.1"
FT                   /translation="MEFFTMCMLAAGFGMAIGAFGTGIGQGLAVKNAVEGVSRNPGASG
FT                   KILTTMMIGLAMIESLAIYVLVVCLIILFANPYKDVAIELAKAVVK"
     MEFFTMCMLA AGFGMAIGAF GTGIGQGLAV KNAVEGVSRN PGASGKILTT MMIGLAMIES        60
     LAIYVLVVCL IILFANPYKD VAIELAKAVV K                                       91
//

If you have problems or comments...

PBIL Back to PBIL home page