(data stored in SCRATCH3701 zone)

EMBL: CP002031.ATPF

CP002031.ATPF        Location/Qualifiers
FT   CDS             92163..92783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpF"
FT                   /locus_tag="KN400_0084"
FT                   /product="ATP synthase F0, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82947"
FT                   /protein_id="ADI82947.1"
FT                   /translation="MAYAFKKNGLLKPFVSTAAICLLVAGTVVLCHASGGGEGAHHVDT
FT                   GKQMKDFMWRVIDFIALAGVIVWALKKANAKGALADRSANVEKALREAEEARTAAEKKF
FT                   AEYSEKLEKANQEIDGIYAAIRKEGELEKERIIAEARITAEKIREQATATATQEVLKAR
FT                   AELRDEAARLAVQMAEQALREAIKKDDQDRLVSEYLTKVENLH"
     MAYAFKKNGL LKPFVSTAAI CLLVAGTVVL CHASGGGEGA HHVDTGKQMK DFMWRVIDFI        60
     ALAGVIVWAL KKANAKGALA DRSANVEKAL REAEEARTAA EKKFAEYSEK LEKANQEIDG       120
     IYAAIRKEGE LEKERIIAEA RITAEKIREQ ATATATQEVL KARAELRDEA ARLAVQMAEQ       180
     ALREAIKKDD QDRLVSEYLT KVENLH                                            206
//

If you have problems or comments...

PBIL Back to PBIL home page