(data stored in SCRATCH3701 zone)

EMBL: CP002031.ATPH

CP002031.ATPH        Location/Qualifiers
FT   CDS             92780..93322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpH"
FT                   /locus_tag="KN400_0085"
FT                   /product="ATP synthase F1, delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82948"
FT                   /protein_id="ADI82948.1"
FT                   /translation="MISNAIARRYAKALVQLGAEEGAVDRFGVELGQFTALLDGNADLA
FT                   SVLKSPAYRIEAKREILRDVLAKLNLSGTVSNFLQVLLDRGRIGFTPQIAHSYAVFADE
FT                   LSGIVRPVLTSAFPLDDAQVEGMKSALAKATGKRVELSAQVDSALIGGVVTKIGDKVFD
FT                   GSVRTQLNRIQDILQKG"
     MISNAIARRY AKALVQLGAE EGAVDRFGVE LGQFTALLDG NADLASVLKS PAYRIEAKRE        60
     ILRDVLAKLN LSGTVSNFLQ VLLDRGRIGF TPQIAHSYAV FADELSGIVR PVLTSAFPLD       120
     DAQVEGMKSA LAKATGKRVE LSAQVDSALI GGVVTKIGDK VFDGSVRTQL NRIQDILQKG       180
//

If you have problems or comments...

PBIL Back to PBIL home page