(data stored in SCRATCH3701 zone)

EMBL: CP002031.ATPZ

CP002031.ATPZ        Location/Qualifiers
FT   CDS             complement(331679..331924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpZ"
FT                   /locus_tag="KN400_0304"
FT                   /product="ATP synthase-associated magnesium import membrane
FT                   protein AtpZ"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83167"
FT                   /protein_id="ADI83167.1"
FT                   /translation="MNDDKRRLIQTLGLVSSMGISVALAIIIGVLIGRQLDKWLGTHPW
FT                   FFFIFLFFGIAAGFRNIYIIAGRAIKKDDGDKDSRE"
     MNDDKRRLIQ TLGLVSSMGI SVALAIIIGV LIGRQLDKWL GTHPWFFFIF LFFGIAAGFR        60
     NIYIIAGRAI KKDDGDKDSR E                                                  81
//

If you have problems or comments...

PBIL Back to PBIL home page